BMRBj - BMREntryMaster

Found 1 Document (1.357 seconds)

BMRB: 4965

2NXN

1H, 15N, and 13C Assignments and Secondary Structure Identification for Full-length Ribosomal Protein L11 from Thermus thermophilus

Authors

Markus, M.A., Triantafillidou, D., Choli-Papadopoulou, T., Torchia, D.A.

Assembly

L11

Entity

1. L11 (polymer, Thiol state: not present), 147 monomers, 15504.93 Da Detail

MKKVVAVVKL QLPAGKATPA PPVGPALGQH GANIMEFVKA FNAATANMGD AIVPVEITIY ADRSFTFVTK TPPASYLIRK AAGLEKGAHK PGREKVGRIT WEQVLEIAKQ KMPDLNTTDL EAAARMIAGS ARSMGVEVVG APEVKDA

Formula weight

15504.93 Da

Source organism

Thermus thermophilus

Exptl. method

NMR

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 99.3 %, Completeness: 91.8 %, Completeness (bb): 97.9 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	91.8 % (1514 of 1650)	87.8 % (750 of 854)	95.4 % (621 of 651)	98.6 % (143 of 145)
Backbone	97.9 % (842 of 860)	97.3 % (287 of 295)	98.4 % (422 of 429)	97.8 % (133 of 136)
Sidechain	86.4 % (799 of 925)	82.5 % (461 of 559)	92.2 % (329 of 357)	100.0 % (9 of 9)
Aromatic	57.9 % (44 of 76)	57.9 % (22 of 38)	56.8 % (21 of 37)	100.0 % (1 of 1)
Methyl	95.3 % (181 of 190)	94.7 % (90 of 95)	95.8 % (91 of 95)

1. ribosomal protein L11

MKKVVAVVKL QLPAGKATPA PPVGPALGQH GANIMEFVKA FNAATANMGD AIVPVEITIY ADRSFTFVTK TPPASYLIRK AAGLEKGAHK PGREKVGRIT WEQVLEIAKQ KMPDLNTTDL EAAARMIAGS ARSMGVEVVG APEVKDA

Show sample condition

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	TSP	methyl protons	external	direct	0.0
¹³C	TSP	methyl protons	null	indirect	0.2514495
¹⁵N	liquid ammonia	nitrogen	external	indirect	0.0

Referencing offset: 0.0 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	TSP	methyl protons	external	direct	0.0
¹³C	TSP	methyl protons	null	indirect	0.2514495
¹⁵N	liquid ammonia	nitrogen	external	indirect	0.0

Referencing offset: 0.0 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	TSP	methyl protons	external	direct	0.0
¹³C	TSP	methyl protons	null	indirect	0.2514495
¹⁵N	liquid ammonia	nitrogen	external	indirect	0.0

Referencing offset: -0.06 ppm, Outliers: 2 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹H	TSP	methyl protons	external	direct	0.0
¹³C	TSP	methyl protons	null	indirect	0.2514495
¹⁵N	liquid ammonia	nitrogen	external	indirect	0.0

Referencing offset: 0.02 ppm, Outliers: 2 Detail

Release date

2001-03-31

Citation

1H, 15N, and 13C assignments and secondary structure identification for full-length ribosomal protein L11 from Thermus thermophilus
Markus, M.A., Triantafillidou, D., Choli-Papadopoulou, T., Torchia, D.A.
J. Biomol. NMR (2001), 20, 293-294, PubMed 11519754 , Abstract

Entries sharing articles BMRB: 1 entries Detail

BMRB: 5513 released on 2003-02-17
Title NMR assignment and secondary structure identification of the ribosomal protein L11 from Thermotoga maritima

Related entities 1. L11, : 1 : 33 : 11 : 282 entities Detail

Interaction partners 1. L11, : 1 interactors Detail

More details for 1 interactors identified by 1 citations

Experiments performed 16 experiments Detail

1 15N HSQC

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

2 HNCACB

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

3 CBCA(CO)NH

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

4 HNCO

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

5 HCACO

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

6 C(CO)NH

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

7 HCCH-TOCSY

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

8 HBHA(CO)NH

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

9 H(CCO)NH

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

10 HNHA

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

11 HNHB

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

12 HAHB

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

13 LRCC

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

14 2D 1H-1H TOCSY

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

15 13C-separated NOESY

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

16 15N-separated NOESY

Instrument

#1 Model Bruker Bruker (500 MHz) Details We used two different spectrometers. One was equipped with a cryoprobe.

#2 Model Bruker Bruker (750 MHz) Details Some of the NOESY spectra were recorded on this spectrometer.

Sample #1

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
1	ribosomal protein L11	[U-99% 15N]	1.06 mM
2	KH2PO4		10 mM
3	KCl		70 mM
4	sodium azide		0.1 mM

Sample #2

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
5	ribosomal protein L11	[U-99% 15N; U-95% 13C]	1.12 mM
6	KH2PO4		10 mM
7	KCl		70 mM
8	sodium azide		0.1 mM

Sample #3

Temperature 298 (±0.5) K, pH 6.5 (±0.2)

#	Name	Isotope labeling	Concentration
9	ribosomal protein L11	[U-99% 15N; U-95% 13C]	0.886 mM
10	D2O		100 %
11	KH2PO4		10 mM
12	KCl		70 mM
13	sodium azide		0.1 mM

Chemical shift validation 3 contents Detail

Properties

Input source #1: Assigned chemical shifts - Assigned chemical shifts	bmr4965_3.str
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Content subtype: bmr4965_3.str

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	L11_shifts	Warning	1722		98.6 (chain: 1, length: 147)
1	Chemical shift references	chemical_shift_reference	OK	2		No information

Assigned chemical shifts

Saveframe: L11_shifts

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: 1, Chain length: 147, Sequence coverage: 98.6%

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRIT
|||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||
MKKVVAVVKLQLPAGKATPA.PVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKT.PASYLIRKAAGLEKGAHKPGREKVGRIT

-------110-------120-------130-------140-------
WEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
|||||||||||||||||||||||||||||||||||||||||||||||
WEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA

Total number of assignments
- ¹H chemical shifts: 941
- ¹³C chemical shifts: 635
- ¹⁵N chemical shifts: 146

Completeness of assignments

Entity_assemble_ID: 1

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
11	GLN	CD	180.07
29	GLN	CD	179.91
33	ASN	CG	177.5
36	GLU	CD	182.91
42	ASN	CG	174.51
47	ASN	CG	177.54
50	ASP	CG	181.09
56	GLU	CD	182.41
85	GLU	CD	183.01
94	GLU	CD	183.81
102	GLU	CD	183.99
103	GLN	CD	180.19
106	GLU	CD	183.41
110	GLN	CD	179.11
114	ASP	CG	179.66
116	ASN	CG	178.14
121	GLU	CD	183.45
137	GLU	CD	183.3
143	GLU	CD	183.93
146	ASP	CG	180.37

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	854	747	87.5
¹³C chemical shifts	651	615	94.5
¹⁵N chemical shifts	151	146	96.7

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	295	290	98.3
¹³C chemical shifts	294	289	98.3
¹⁵N chemical shifts	136	134	98.5

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	559	457	81.8
¹³C chemical shifts	357	326	91.3
¹⁵N chemical shifts	15	12	80.0

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	101	97	96.0
¹³C chemical shifts	101	97	96.0

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	38	22	57.9
¹³C chemical shifts	37	21	56.8
¹⁵N chemical shifts	1	1	100.0

Peptide bond of PRO
Tautomeric state of HIS
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: 1

Keywords antibiotic target, chemical shift assignments, ribosomal protein, RNA-protein interaction, secondary structure

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.357 seconds)

BMRB: 4965

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Entries sharing articles BMRB: 1 entries Detail

Related entities 1. L11, : 1 : 33 : 11 : 282 entities Detail

Interaction partners 1. L11, : 1 interactors Detail

Experiments performed 16 experiments Detail

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3

Instrument

Sample #1

Sample #2

Sample #3