Backbone Assignment of Endonuclease V from Bacteriophage T4 with deuterium labeling
MTRINLTLVS ELADQHLMAE YRELPRVFGA VRKHVANGKR VRDFKISPTF ILGAGHVTFF YDKLEFLRKR QIELIAECLK RGFNIKDTTV QDISDIPQEF RGDYIPHEAS IAISQARLDE KIAQRPTWYK YYGKAIYA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 49.2 % (831 of 1690) | 33.0 % (291 of 883) | 61.7 % (410 of 664) | 90.9 % (130 of 143) |
Backbone | 95.2 % (779 of 818) | 91.4 % (254 of 278) | 97.1 % (395 of 407) | 97.7 % (130 of 133) |
Sidechain | 17.9 % (180 of 1003) | 6.1 % (37 of 605) | 36.9 % (143 of 388) | 0.0 % (0 of 10) |
Aromatic | 4.9 % (8 of 164) | 6.1 % (5 of 82) | 3.7 % (3 of 81) | 0.0 % (0 of 1) |
Methyl | 14.2 % (23 of 162) | 7.4 % (6 of 81) | 21.0 % (17 of 81) |
1. endonuclease V
MTRINLTLVS ELADQHLMAE YRELPRVFGA VRKHVANGKR VRDFKISPTF ILGAGHVTFF YDKLEFLRKR QIELIAECLK RGFNIKDTTV QDISDIPQEF RGDYIPHEAS IAISQARLDE KIAQRPTWYK YYGKAIYATemperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | null | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | null | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | null | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | null | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
#1 Model Bruker DRX (500 MHz)
#2 Model Bruker DRX (600 MHz)
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | endonuclease V | [U-15N]-Ala, Asp, Arg, Gly, Lys, Ser, Thr, Tyr, Val | 1.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | endonuclease V | [U-15N] | 2.0 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | endonuclease V | [U-70% 2H ; U-15N] | 1.5 mM |
Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | endonuclease V | [U-90% 2H; U-13C; U-15N] | 1.5 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr5244_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTRINLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKLEFLRKRQIELIAECLKRGFNIKDTTVQDISDIPQEF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TRINLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKLEFLRKRQIELIAECLKRGFNIKDTTVQDISDIPQEF -------110-------120-------130-------- RGDYIPHEASIAISQARLDEKIAQRPTWYKYYGKAIYA |||||||||||||||||||||||||||||||||||||| RGDYIPHEASIAISQARLDEKIAQRPTWYKYYGKAIYA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 664 | 395 | 59.5 |
15N chemical shifts | 155 | 131 | 84.5 |
1H chemical shifts | 883 | 253 | 28.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 276 | 268 | 97.1 |
15N chemical shifts | 133 | 131 | 98.5 |
1H chemical shifts | 278 | 253 | 91.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 388 | 127 | 32.7 |
15N chemical shifts | 22 | 0 | 0.0 |
1H chemical shifts | 605 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 83 | 12 | 14.5 |
1H chemical shifts | 83 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 81 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
1H chemical shifts | 82 | 0 | 0.0 |