1H, 13C, and 15N Chemical Shift Assignments for a PWWP domain from Sch. pombe
GSERVNYKPG MRVLTKMSGF PWWPSMVVTE SKMTSVARKS KPKRAGTFYP VIFFPNKEYL WTGSDSLTPL TSEAISQFLE KPKPKTASLI KAYKMAQSTP DLDSLSVPS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.5 % (1132 of 1308) | 96.4 % (661 of 686) | 70.8 % (366 of 517) | 100.0 % (105 of 105) |
Backbone | 96.2 % (608 of 632) | 95.3 % (202 of 212) | 95.7 % (308 of 322) | 100.0 % (98 of 98) |
Sidechain | 79.7 % (622 of 780) | 96.8 % (459 of 474) | 52.2 % (156 of 299) | 100.0 % (7 of 7) |
Aromatic | 54.2 % (64 of 118) | 96.6 % (57 of 59) | 7.1 % (4 of 56) | 100.0 % (3 of 3) |
Methyl | 96.1 % (98 of 102) | 96.1 % (49 of 51) | 96.1 % (49 of 51) |
1. PWWP domain
GSERVNYKPG MRVLTKMSGF PWWPSMVVTE SKMTSVARKS KPKRAGTFYP VIFFPNKEYL WTGSDSLTPL TSEAISQFLE KPKPKTASLI KAYKMAQSTP DLDSLSVPSTemperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Bruker Advance - 800 MHz
State isotropic, Temperature 290 (±0.1) K, pH 6.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PWWP domain | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium phosphate | 50 mM | ||
3 | NaCl | 300 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr5538_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEYLWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEYLWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTP --------- DLDSLSVPS ||||||||| DLDSLSVPS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
15 | THR | HG1 | 4.59 |
25 | SER | HG | 3.57 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 517 | 364 | 70.4 |
1H chemical shifts | 686 | 673 | 98.1 |
15N chemical shifts | 109 | 104 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 218 | 214 | 98.2 |
1H chemical shifts | 212 | 208 | 98.1 |
15N chemical shifts | 98 | 97 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 299 | 150 | 50.2 |
1H chemical shifts | 474 | 465 | 98.1 |
15N chemical shifts | 11 | 7 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 56 | 56 | 100.0 |
1H chemical shifts | 56 | 56 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 56 | 0 | 0.0 |
1H chemical shifts | 59 | 56 | 94.9 |
15N chemical shifts | 3 | 3 | 100.0 |