Assignments of 1H, 15N and 13C resonances of the proline-rich matrix protein of Moloney Murine Leukemia Virus (MA Mo-MuLV)
MGQTVTTPLS LTLGHWKDVE RIAHNQSVDV KKRRWVTFCS AEWPTFNVGW PRDGTFNRDL ITQVKIKVFS PGPHGHPDQV PYIVTWEALA FDPPPWVKPF VHPKPPPPLP PSAPSLPLEP PRSTPPRSSL Y
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.1 % (1425 of 1581) | 85.4 % (709 of 830) | 94.8 % (598 of 631) | 98.3 % (118 of 120) |
Backbone | 97.0 % (716 of 738) | 97.5 % (238 of 244) | 96.4 % (373 of 387) | 98.1 % (105 of 107) |
Sidechain | 85.7 % (830 of 968) | 80.4 % (471 of 586) | 93.8 % (346 of 369) | 100.0 % (13 of 13) |
Aromatic | 89.3 % (150 of 168) | 79.8 % (67 of 84) | 98.7 % (77 of 78) | 100.0 % (6 of 6) |
Methyl | 96.2 % (125 of 130) | 95.4 % (62 of 65) | 96.9 % (63 of 65) |
1. matrix protein
MGQTVTTPLS LTLGHWKDVE RIAHNQSVDV KKRRWVTFCS AEWPTFNVGW PRDGTFNRDL ITQVKIKVFS PGPHGHPDQV PYIVTWEALA FDPPPWVKPF VHPKPPPPLP PSAPSLPLEP PRSTPPRSSL YTemperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Bruker AvanceDMX - 500 MHz
State isotropic, Temperature 303 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | matrix protein | [U-95% 13C; U-90% 15N] | 1.0 ~ 1.2 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr5623_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| .GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDP.PWVKPF -------110-------120-------130- VHPKPPPPLPPSAPSLPLEPPRSTPPRSSLY ||||||||||||||||||||||||||||||| VHPKPPPPLPPSAPSLPLEPPRSTPPRSSLY
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | PRO | N | 134.386 |
18 | ASP | CG | 179.716 |
20 | GLU | CD | 183.908 |
25 | ASN | CG | 176.427 |
29 | ASP | CG | 180.168 |
44 | PRO | N | 137.515 |
47 | ASN | CG | 178.104 |
51 | PRO | N | 145.257 |
53 | ASP | CG | 180.748 |
57 | ASN | CG | 176.299 |
59 | ASP | CG | 179.587 |
63 | GLN | CD | 179.523 |
71 | PRO | N | 137.588 |
77 | PRO | N | 139.328 |
81 | PRO | N | 132.575 |
87 | GLU | CD | 183.392 |
92 | ASP | CG | 181.006 |
93 | PRO | N | 137.68 |
95 | PRO | N | 134.222 |
99 | PRO | N | 133.563 |
103 | PRO | N | 137.186 |
105 | PRO | N | 138.669 |
106 | PRO | N | 134.551 |
107 | PRO | N | 136.198 |
108 | PRO | N | 134.551 |
110 | PRO | N | 137.351 |
114 | PRO | N | 135.539 |
119 | GLU | CD | 184.037 |
120 | PRO | N | 135.869 |
125 | PRO | N | 140.481 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 830 | 690 | 83.1 |
15N chemical shifts | 127 | 119 | 93.7 |
13C chemical shifts | 631 | 595 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 240 | 98.4 |
15N chemical shifts | 107 | 106 | 99.1 |
13C chemical shifts | 262 | 254 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 586 | 450 | 76.8 |
15N chemical shifts | 20 | 13 | 65.0 |
13C chemical shifts | 369 | 341 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 59 | 89.4 |
13C chemical shifts | 66 | 61 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 67 | 79.8 |
15N chemical shifts | 6 | 6 | 100.0 |
13C chemical shifts | 78 | 77 | 98.7 |