Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr62_3.str

Assigned chemical shifts

1. Saveframe: chemical_shift_assignment_data_set_one
   • Status: Warning
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 108, Sequence coverage: 87.0%

     --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
     SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAKSKGQLK
       ||||||||||||||||||||||||||||||| ||||| ||||||||||||||||||||||| ||| ||||||| ||||||||||||||||||||||||
     ..KIIHLTDDSFDTDVLKADGAILVDFWAEWCG.CKMIA.ILDEIADEYQGKLTVAKLNIDQN.GTA.KYGIRGI.TLLLFKNGEVAATKVGAKSKGQLK
     --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
     
     --------
     EFLDANLA
     |       
     E       
     -       
     

   • Total number of assignments
     • ¹H chemical shifts: 357
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	640	337	52.7

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	220	197	89.5

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	420	140	33.3

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	71	10	14.1

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	42	0	0.0

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1