1H, 13C, and 15N chemical shift assignments for the catalytic domain of MMP-12
MFREMPGGPV WRKHYITYRI NNYTPDMNRE DVDYAIRKAF QVWSNVTPLK FSKINTGMAD ILVVFARGAH GDFHAFDGKG GILAHAFGPG SGIGGDAHFD EDEFWTTHSG GTNLFLTAVH EIGHSLGLGH SSDPKAVMFP TYKYVDINTF RLSADDIRGI QSLYG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.3 % (1633 of 1893) | 83.9 % (815 of 971) | 87.6 % (659 of 752) | 93.5 % (159 of 170) |
Backbone | 95.1 % (928 of 976) | 94.2 % (323 of 343) | 96.4 % (458 of 475) | 93.0 % (147 of 158) |
Sidechain | 79.7 % (846 of 1062) | 78.3 % (492 of 628) | 81.0 % (342 of 422) | 100.0 % (12 of 12) |
Aromatic | 46.4 % (115 of 248) | 46.8 % (58 of 124) | 44.6 % (54 of 121) | 100.0 % (3 of 3) |
Methyl | 100.0 % (160 of 160) | 100.0 % (80 of 80) | 100.0 % (80 of 80) |
1. mmp12
MFREMPGGPV WRKHYITYRI NNYTPDMNRE DVDYAIRKAF QVWSNVTPLK FSKINTGMAD ILVVFARGAH GDFHAFDGKG GILAHAFGPG SGIGGDAHFD EDEFWTTHSG GTNLFLTAVH EIGHSLGLGH SSDPKAVMFP TYKYVDINTF RLSADDIRGI QSLYGPressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | nitrogen | 0.0 ppm | external | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | nitrogen | 0.0 ppm | external | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | nitrogen | 0.0 ppm | external | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | nitrogen | 0.0 ppm | external | indirect | 0.101329 |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Model Bruker DRX (600 MHz) Details Triple resonance, single-axis gradient, cryoprobe for most experiments.
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | mmp12 | [U-15N] | 0.2 mM | |
2 | inhibitor | 0.2 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C 15N labelled MMP-12 (with bound inhibitor).
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | mmp12 | [U-13C; U-15N] | 0.7 mM | |
4 | inhibitor | 0.7 mM |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 13C, 15N labelled MMP-12 (with bound inhibitor) in 2H2O.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | mmp12 | [U-13C; U-15N] | 0.4 mM | |
6 | inhibitor | 0.4 mM | ||
7 | D2O | 100 % |
Pressure 1 (±0.1) atm, Temperature 298 (±1.0) K, pH 6.0 (±0.2), Details 10% 13C labelled MMP-12 with bound inhibitor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | mmp12 | [U-10% 13C] | 0.55 mM | |
9 | inhibitor | 0.55 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6391_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFD -------110-------120-------130-------140-------150-------160----- EDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 752 | 663 | 88.2 |
1H chemical shifts | 971 | 816 | 84.0 |
15N chemical shifts | 178 | 169 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 330 | 321 | 97.3 |
1H chemical shifts | 343 | 328 | 95.6 |
15N chemical shifts | 158 | 150 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 422 | 342 | 81.0 |
1H chemical shifts | 628 | 488 | 77.7 |
15N chemical shifts | 20 | 19 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 85 | 82 | 96.5 |
1H chemical shifts | 85 | 82 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 121 | 54 | 44.6 |
1H chemical shifts | 124 | 58 | 46.8 |
15N chemical shifts | 3 | 3 | 100.0 |