Backbone and side chain chemical shift assignments of a TRAV14-3 mouse T cell receptor domain
MQQVRQSPQS LTVWEGETAI LNCSYENSAF DYFPWYQQFP GEGPALLISI LSVSNKKEDG RFTIFFNKRE KKLSLHIADS QPGDSATYFC AASASFGDNS KLIWGLGTSL VVNP
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 0:CYS23:SG | 1:CYS90:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.3 % (1249 of 1338) | 92.6 % (642 of 693) | 93.1 % (485 of 521) | 98.4 % (122 of 124) |
Backbone | 97.9 % (658 of 672) | 96.5 % (222 of 230) | 98.8 % (330 of 334) | 98.1 % (106 of 108) |
Sidechain | 90.3 % (697 of 772) | 90.7 % (420 of 463) | 89.1 % (261 of 293) | 100.0 % (16 of 16) |
Aromatic | 62.5 % (95 of 152) | 64.5 % (49 of 76) | 58.9 % (43 of 73) | 100.0 % (3 of 3) |
Methyl | 100.0 % (110 of 110) | 100.0 % (55 of 55) | 100.0 % (55 of 55) |
1. TCR Va2.6 domain
MQQVRQSPQS LTVWEGETAI LNCSYENSAF DYFPWYQQFP GEGPALLISI LSVSNKKEDG RFTIFFNKRE KKLSLHIADS QPGDSATYFC AASASFGDNS KLIWGLGTSL VVNPTemperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
#1 Model Bruker DMX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TCR Va2.6 domain | [U-95% 15N] | 0.94 mM |
Temperature 300 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | TCR Va2.6 domain | [U-95% 13C; U-95% 15N] | 0.91 mM |
Properties
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:23:CYS:SG | 1:90:CYS:SG | oxidized, CA 54.71, CB 43.6 ppm | oxidized, CA 52.81, CB 44.02 ppm | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6406_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSNKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSNKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNS -------110---- KLIWGLGTSLVVNP |||||||||||||| KLIWGLGTSLVVNP
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
22 | ASN | CG | 176.538 |
55 | ASN | CG | 177.289 |
79 | ASP | CG | 170.72 |
84 | ASP | CG | 179.729 |
99 | ASN | CG | 177.17 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 693 | 648 | 93.5 |
13C chemical shifts | 521 | 484 | 92.9 |
15N chemical shifts | 127 | 120 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 230 | 226 | 98.3 |
13C chemical shifts | 228 | 223 | 97.8 |
15N chemical shifts | 108 | 104 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 463 | 422 | 91.1 |
13C chemical shifts | 293 | 261 | 89.1 |
15N chemical shifts | 19 | 16 | 84.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 56 | 100.0 |
13C chemical shifts | 56 | 56 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 46 | 60.5 |
13C chemical shifts | 73 | 43 | 58.9 |
15N chemical shifts | 3 | 3 | 100.0 |