BMRBj - BMREntryMaster

Found 1 Document (1.417 seconds)

BMRB: 6658

2JTN

NMR Solution Structure of a ldb1-LID:Lhx3-LIM complex

Authors

Lee, C., Nancarrow, A.L., Mackay, J.P., Matthews, J.M.

Assembly

FLIX3

Entity

1. FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains (polymer, Thiol state: free and other bound), 182 monomers, 20235.76 Da Detail

SSQVPDVMVV GEPTLMGGEF GDEDERLITR LENTQFDAAN GIDDEGGSGG HMGSGGTPEI PMCAGCDQHI LDRFILKALD RHWHSKCLKC SDCHVPLAER CFSRGESVYC KDDFFKRFGT KCAACQLGIP PTQVVRRAQD FVYHLHCFAC VVCKRQLATG DEFYLMEDSR LVCKADYETA KQ

2. ZN (non-polymer), 65.409 × 4 Da

Total weight

20497.396 Da

Max. entity weight

20235.76 Da

Entity Connection

na 16 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	na	sing	1:CYS63:SG	2:ZN1:ZN
2	na	sing	1:CYS66:SG	2:ZN1:ZN
3	na	sing	1:CYS87:SG	2:ZN1:ZN
4	na	sing	1:HIS84:ND1	2:ZN1:ZN
5	na	sing	1:CYS90:SG	2:ZN1:ZN
6	na	sing	1:CYS93:SG	2:ZN1:ZN
7	na	sing	1:CYS110:SG	2:ZN1:ZN
8	na	sing	1:ASP113:OD1	2:ZN1:ZN
9	na	sing	1:CYS122:SG	2:ZN1:ZN
10	na	sing	1:CYS125:SG	2:ZN1:ZN
11	na	sing	1:CYS147:SG	2:ZN1:ZN
12	na	sing	1:HIS144:ND1	2:ZN1:ZN
13	na	sing	1:CYS150:SG	2:ZN1:ZN
14	na	sing	1:CYS153:SG	2:ZN1:ZN
15	na	sing	1:CYS173:SG	2:ZN1:ZN
16	na	sing	1:ASP176:OD1	2:ZN1:ZN

Source organism

Mus musculus

Exptl. method

solution NMR

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 95.1 %, Completeness: 88.6 %, Completeness (bb): 91.0 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	88.6 % (1809 of 2041)	88.1 % (933 of 1059)	88.7 % (706 of 796)	91.4 % (170 of 186)
Backbone	91.0 % (981 of 1078)	90.6 % (339 of 374)	90.9 % (481 of 529)	92.0 % (161 of 175)
Sidechain	87.3 % (985 of 1128)	86.7 % (594 of 685)	88.4 % (382 of 432)	81.8 % (9 of 11)
Aromatic	75.6 % (130 of 172)	81.4 % (70 of 86)	69.4 % (59 of 85)	100.0 % (1 of 1)
Methyl	95.7 % (157 of 164)	96.3 % (79 of 82)	95.1 % (78 of 82)

1. FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains

Show sample condition

Sample #1

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.8, Details 0.75 mM U-[13C, 15N] FLIX3 protein, 20 mM sodium phosphate, 40 mM NaCl, 1 mM DTT, pH 6.8; 90% H2O, 10% D2O

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

Sample #2

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.8, Details 1.2 mM FLIX3 protein, 20 mM sodium phosphate, 40 mM NaCl, 1 mM DTT, pH 6.8; 90% H2O, 10% D2O

#	Name	Isotope labeling	Concentration
9	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	natural abundance	1.2 mM
10	ZINC ION	natural abundance	4.8 mM
11	DSS	natural abundance	15.0 ~ 30.0 uM
12	DTT	natural abundance	1 mM
13	sodium phosphate	natural abundance	20 mM
14	sodium chloride	natural abundance	40 mM
15	H2O	natural abundance	90 %
16	D2O	[U-99% 2H]	10 %

Sample #3

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.8, Details 0.6 mM 10%-13C, U-[15N] FLIX3 protein, 20 mM sodium phosphate, 40 mM NaCl, 1 mM DTT, pH 6.8; 90% H2O, 10% D2O

#	Name	Isotope labeling	Concentration
17	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-10% 13C; U-99% 15N]	0.6 mM
18	ZINC ION	natural abundance	2.4 mM
19	DSS	natural abundance	15.0 ~ 30.0 uM
20	DTT	natural abundance	1 mM
21	sodium phosphate	natural abundance	20 mM
22	sodium chloride	natural abundance	40 mM
23	D2O	[U-99% 2H]	90 %
24	H2O	natural abundance	10 %

Sample #4

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.8, Details 0.3 mM U-[15N] FLIX3 protein, 20 mM sodium phosphate, 40 mM NaCl, 1 mM DTT, pH 6.8; 90% H2O, 10% D2O

#	Name	Isotope labeling	Concentration
25	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 15N]	0.3 mM
26	ZINC ION	natural abundance	1.2 mM
27	DSS	natural abundance	15.0 ~ 30.0 uM
28	DTT	natural abundance	1 mM
29	sodium phosphate	natural abundance	20 mM
30	sodium chloride	natural abundance	40 mM
31	D2O	[U-99% 2H]	90 %
32	H2O	natural abundance	10 %

Sample #5

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.8, Details 0.6 mM U-[13C, 15N] FLIX3 protein, 20 mM sodium phosphate, 40 mM NaCl, 1 mM DTT, pH 6.8; 99% D2O

#	Name	Isotope labeling	Concentration
33	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.6 mM
34	ZINC ION	natural abundance	2.4 mM
35	DSS	natural abundance	15.0 ~ 30.0 uM
36	DTT	natural abundance	1 mM
37	sodium phosphate	natural abundance	20 mM
38	sodium chloride	natural abundance	40 mM
39	D2O	[U-99% 2H]	99 %
40	H2O	natural abundance	1 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.16 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.16 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.02 ppm, Outliers: 3 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.39 ppm, Outliers: 4 Detail

Release date

2005-12-13

Citation

1H, 15N and 13C assignments of an intramolecular Lhx3:ldb1 complex
Lee, C., Nancarrow, A.L., Bach, I., Mackay, J.P., Matthews, J.M.
J. Biomol. NMR (2005), 33, 198-198, PubMed 16331426 , DOI 10.1007/s10858-005-3209-7 , Abstract

Related entities 1. FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains, : 1 : 14 entities Detail

Experiments performed 17 experiments Detail

1 HNCO

Instrument

Bruker DRX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.8, Details 0.75 mM U-[13C, 15N] FLIX3 protein, 20 mM sodium phosphate, 40 mM NaCl, 1 mM DTT, pH 6.8; 90% H2O, 10% D2O

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

2 HNCA

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

3 HNCACO

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

4 HNCOCA

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

5 HCCH-TOCSY

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

6 HCCH-COSY

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

7 HNHA

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

8 15N-HSQC

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

9 13C-CT-HSQC

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

10 2D-homonuclear TOCSY

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

11 2D-homonuclear NOESY

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

12 HNCACB

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

13 CBCACONH

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

14 3D 15N-separated NOESY

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

15 3D 13C-separated NOESY

Instrument

Bruker Avance - 800 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

16 15N-HSQC (optimised for histidine sidechain J-coupling)

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

17 13C-CT-HSQC (10% 13C sample)

Instrument

Bruker DRX - 600 MHz

Sample

#	Name	Isotope labeling	Concentration
1	FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains	[U-99% 13C; U-99% 15N]	0.75 mM
2	ZINC ION	natural abundance	3 mM
3	DSS	natural abundance	15.0 ~ 30.0 uM
4	DTT	natural abundance	1 mM
5	sodium phosphate	natural abundance	20 mM
6	sodium chloride	natural abundance	40 mM
7	D2O	[U-99% 2H]	10 %
8	H2O	natural abundance	90 %

Chemical shift validation 4 contents Detail

Properties

Input source #1: Assigned chemical shifts - Assigned chemical shifts	bmr6658_3.str
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
1:63:CYS:SG	2:1:ZN:ZN	reduced, CA 58.258, CB 30.77 ppm	unknown	n/a
1:66:CYS:SG	2:1:ZN:ZN	oxidized 13.3%, reduced 86.7%, CA 58.161, CB 32.099 ppm	unknown	n/a
1:87:CYS:SG	2:1:ZN:ZN	oxidized 4.0%, reduced 96.0%, CA 61.339, CB 32.601 ppm	unknown	n/a
1:84:HIS:ND1	2:1:ZN:ZN	unknown	unknown	n/a
1:90:CYS:SG	3:1:ZN:ZN	reduced, CA 59.856, CB 31.842 ppm	unknown	n/a
1:93:CYS:SG	3:1:ZN:ZN	reduced, CA 59.22, CB 30.186 ppm	unknown	n/a
1:110:CYS:SG	3:1:ZN:ZN	reduced, CA 57.107, CB 30.594 ppm	unknown	n/a
1:113:ASP:OD1	3:1:ZN:ZN	unknown	unknown	n/a
1:122:CYS:SG	4:1:ZN:ZN	reduced, CA 58.022, CB 31.163 ppm	unknown	n/a
1:125:CYS:SG	4:1:ZN:ZN	reduced, CA 59.388, CB 30.945 ppm	unknown	n/a
1:147:CYS:SG	4:1:ZN:ZN	reduced, CA 60.667, CB 31.028 ppm	unknown	n/a
1:144:HIS:ND1	4:1:ZN:ZN	unknown	unknown	n/a
1:150:CYS:SG	5:1:ZN:ZN	reduced, CA 58.51, CB 31.713 ppm	unknown	n/a
1:153:CYS:SG	5:1:ZN:ZN	reduced, CA 59.325, CB 29.876 ppm	unknown	n/a
1:173:CYS:SG	5:1:ZN:ZN	reduced, CA 58.812, CB 29.843 ppm	unknown	n/a
1:176:ASP:OD1	5:1:ZN:ZN	unknown	unknown	n/a

Non-standard residues

None

Content subtype: bmr6658_3.str

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1983		94.0 (chain: 1, length: 182)
1	Chemical shift references	chemical_shift_reference_1	OK	3		No information

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: 1, Chain length: 182, Sequence coverage: 94.0%

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
SSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEGGSGGHMGSGGTPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAER
  ||||||||||||||||||||||||||||||||||||||||||||         |||||||||||||||||||||||||||||||||||||||||||||
..QVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEG.........GTPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAER

-------110-------120-------130-------140-------150-------160-------170-------180--
CFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQ
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
CFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQ

Total number of assignments
- ¹H chemical shifts: 1099
- ¹³C chemical shifts: 701
- ¹⁵N chemical shifts: 183

Completeness of assignments

Entity_assemble_ID: 1

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
69	HIS	ND1	218.595
69	HIS	NE2	184.722
82	HIS	ND1	225.025
82	HIS	NE2	170.459
84	HIS	ND1	213.397
84	HIS	NE2	179.298
94	HIS	ND1	214.501
94	HIS	NE2	173.724
104	ARG	HH11	7.763
104	ARG	HH21	7.077
104	ARG	NH1	112.431
104	ARG	NH2	112.563
144	HIS	ND1	236.63
144	HIS	NE2	174.016

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	1059	929	87.7
¹³C chemical shifts	796	701	88.1
¹⁵N chemical shifts	197	171	86.8

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	374	335	89.6
¹³C chemical shifts	364	320	87.9
¹⁵N chemical shifts	175	160	91.4

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	685	594	86.7
¹³C chemical shifts	432	381	88.2
¹⁵N chemical shifts	22	11	50.0

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	87	84	96.6
¹³C chemical shifts	87	82	94.3

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	86	70	81.4
¹³C chemical shifts	85	59	69.4
¹⁵N chemical shifts	1	1	100.0

Redox state of CYS
Peptide bond of PRO
Tautomeric state of HIS
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: 1

Keywords intramolecular (fusion) protein-protein complex

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.417 seconds)

BMRB: 6658

Sample #1

Sample #2

Sample #3

Sample #4

Sample #5

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. FLIX3 - Fusion of ldb1-LID and Lhx3 LIM domains, : 1 : 14 entities Detail

Experiments performed 17 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Chemical shift validation 4 contents Detail