Backbone 1H, 13C, and 15N Chemical Shift Assignments for Bacillus Subilis YqaI Dimer
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.8 % (785 of 865) | 90.0 % (403 of 448) | 91.4 % (309 of 338) | 92.4 % (73 of 79) |
Backbone | 93.2 % (399 of 428) | 92.5 % (135 of 146) | 93.4 % (198 of 212) | 94.3 % (66 of 70) |
Sidechain | 89.1 % (450 of 505) | 88.7 % (268 of 302) | 90.2 % (175 of 194) | 77.8 % (7 of 9) |
Aromatic | 76.6 % (72 of 94) | 76.6 % (36 of 47) | 76.1 % (35 of 46) | 100.0 % (1 of 1) |
Methyl | 94.7 % (72 of 76) | 94.7 % (36 of 38) | 94.7 % (36 of 38) |
1. YqaI
MVENPMVINN WHDKLTETDV QIDFYGDEVT PVDDYVIDGG EIILRENLER YLREQLGFEF KNAQLEHHHH HHTemperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Varian Inova - 600 MHz
State isotropic, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YqaI | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | 20 mM | ||
3 | NaCL | 100 mM | ||
4 | DTT | 10 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr7192_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-- MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQLEHHH --------10--------20--------30--------40--------50--------60---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 338 | 306 | 90.5 |
1H chemical shifts | 448 | 408 | 91.1 |
15N chemical shifts | 82 | 75 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 144 | 132 | 91.7 |
1H chemical shifts | 146 | 136 | 93.2 |
15N chemical shifts | 70 | 65 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 194 | 174 | 89.7 |
1H chemical shifts | 302 | 272 | 90.1 |
15N chemical shifts | 12 | 10 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 40 | 37 | 92.5 |
1H chemical shifts | 40 | 37 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 46 | 35 | 76.1 |
1H chemical shifts | 47 | 36 | 76.6 |
15N chemical shifts | 1 | 1 | 100.0 |