Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Sequence alignments

• Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-------                                                                                             
.TEFKAG                                                                                             
 ||||||                                                                                             
-TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNHAKYIPGTKMAFGGLKKEKDRNDL
 ---------10--------20--------30--------40--------50--------60--------70--------80--------90-------1

         
         
         
ITYLKKATE
00-------

Chain assignments

Content subtype: combined_17903_2lir.nef

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: Warning

Covalent bonds

1. Saveframe: assembly
   • Status: Warning

Distance restraints

1. Saveframe: CNS/XPLOR_distance_constraints_2
   • Status: Error
   • Experiment type: noe
   • Sequence coverage of experimental data
     • Entity_assembly_ID: B, Chain length: 1, Sequence coverage: 100.0%

     -
     X
     |
     X
     

   • Total number of restraints: 2306
     • Intra-residue restraints, i = j : 793
     • Sequential restraints, | i - j | = 1 : 386
       • Backbone-backbone: 144
       • Backbone-side chain: 200
       • Side chain-side chain: 42
     • Medium range restraints, 1 < | i - j | < 5 : 396
       • Backbone-backbone: 140
       • Backbone-side chain: 156
       • Side chain-side chain: 100
     • Long range restraints, | i - j | >= 5 : 604
     • Inter-chain restraints: 29
     • Symmetric restraints: 98
   • Weight of restraints: 1.0 (2306)
     • Intra-residue restraints, i = j : 1.0 (793)
     • Sequential restraints, | i - j | = 1 : 1.0 (386)
       • Backbone-backbone: 1.0 (144)
       • Backbone-side chain: 1.0 (200)
       • Side chain-side chain: 1.0 (42)
     • Medium range restraints, 1 < | i - j | < 5 : 1.0 (396)
       • Backbone-backbone: 1.0 (140)
       • Backbone-side chain: 1.0 (156)
       • Side chain-side chain: 1.0 (100)
     • Long range restraints, | i - j | >= 5 : 1.0 (604)
     • Inter-chain restraints: 1.0 (29)
     • Symmetric restraints: 1.0 (98)
   • Potential type of restraints: square-well-parabolic (2306)
     • Intra-residue restraints, i = j : square-well-parabolic (793)
     • Sequential restraints, | i - j | = 1 : square-well-parabolic (386)
       • Backbone-backbone: square-well-parabolic (144)
       • Backbone-side chain: square-well-parabolic (200)
       • Side chain-side chain: square-well-parabolic (42)
     • Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (396)
       • Backbone-backbone: square-well-parabolic (140)
       • Backbone-side chain: square-well-parabolic (156)
       • Side chain-side chain: square-well-parabolic (100)
     • Long range restraints, | i - j | >= 5 : square-well-parabolic (604)
     • Inter-chain restraints: square-well-parabolic (29)
     • Symmetric restraints: square-well-parabolic (98)
   • Range of distance target values: 2.35, 4.05 (Å)
   • Histogram of distance target values
   • Histogram of discrepancy in distance target values
   • Distance restraints per residue
     • Chain_ID: A
     • Chain_ID: B
   • Distance restraints on contact map
     • Chain_ID_1: B - Chain_ID_2: B